Gene Mb2429c
in Mycobacterium bovis AF2122/97
General annotation
Type | CDS |
Function | Unknown |
Product | conserved protein |
Comments | Mb2429c, -, len: 142 aa. Equivalent to Rv2406c,len: 142 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 142 aa overlap). Conserved hypothetical protein. C-terminal region is identical with many CBS DOMAIN PROTEIN e.g. AAK46774|MT2478 CBS DOMAIN PROTEIN from Mycobacterium tuberculosis strain CDC1551 (aa 47-142), FASTA scores: opt: 594, E(): 1.9e-30, (98.97% identity in 97 aa overlap); etc. Also similar to other hypothetical proteins e.g. AAK24594|CC2626 CBS DOMAIN PROTEIN from Caulobacter crescentus (157 aa), FASTA scores: opt: 377, E(): 8.3e-17, (42.55% identity in 141 aa overlap); BAB47826|MLR0188 from Rhizobium loti; etc. |
Functional category | Conserved hypotheticals |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 2672078 | 2672506 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2429c|Mb2429c MRIADVLRNKGAAVVTINPDATVGELLAGLAEQNIGAMVVVGAEGVVGIVSERDVVRQLHTYGASVLSRPVAKIMSTTVATCTKSDTVDKISVLMTENRVRHVPVLDGKKLIGIVSIGDVVKSRMGELEAEQQQLQSYITQG
Bibliography
No article yet recorded