Gene Mb2457c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | pe family protein pe25 |
| Comments | Mb2457c, PE25, len: 99 aa. Equivalent to Rv2431c,len: 99 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 99 aa overlap). Member of the Mycobacterium tuberculosis PE family (see first citation below), similar to others e.g. AAK47158|MT2839 from Mycobacterium tuberculosis (275 aa) FASTA scores: opt: 194, E(): 2.5e-06, (40.0% identity in 95 aa overlap); etc. |
| Functional category | |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2696130 | 2696429 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2457c|PE25
MSFVITNPEALTVAATEVRRIRDRAIQSDAQVAPMTTAVRPPAADLVSEKAATFLVEYARKYRQTIAAAAVVLEEFAHALTTGADKYATAEADNIKTFS
Bibliography
No article yet recorded