Gene Mb2468c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | 50s ribosomal protein l27 rpma |
| Comments | Mb2468c, rpmA, len: 86 aa. Equivalent to Rv2441c,len: 86 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 86 aa overlap). Probable rpmA, 50S RIBOSOMAL PROTEINS L27, equivalent to Q9CBZ3|RL27_MYCLE from Mycobacterium leprae (88 aa), FASTA scores: opt: 504,E(): 7.6e-28, (93.2% identity in 81 aa overlap). Also highly similar to others e.g. P95757|RL27_STRGR from Streptomyces griseus (85 aa), FASTA scores: opt: 442, E(): 1.2e-23, (81.5% identity in 81 aa overlap); etc. Contains PS00831 Ribosomal protein L27 signature. BELONGS TO THE L27P FAMILY OF RIBOSOMAL PROTEINS. |
| Functional category | |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2707935 | 2708195 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2468c|rpmA
MAHKKGASSSRNGRDSAAQRLGVKRYGGQVVKAGEILVRQRGTKFHPGVNVGRGGDDTLFAKTAGAVEFGIKRGRKTVSIVGSTTA
Bibliography
No article yet recorded