Gene Mb2469c
in Mycobacterium bovis AF2122/97
General annotation
Type | CDS |
Function | Unknown |
Product | 50s ribosomal protein l21 rplu |
Comments | Mb2469c, rplU, len: 104 aa. Equivalent to Rv2442c,len: 104 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 104 aa overlap). Probable rplU, 50S RIBOSOMAL PROTEIN L21, equivalent to Q9CBZ2|RL21_MYCLE from Mycobacterium leprae (103 aa), FASTA scores: opt: 579, E(): 4.8e-31, (91.1% identity in 102 aa overlap). Also highly similar to others e.g. P95756|RL21_STRGR from Streptomyces griseus (106 aa), FASTA scores: opt: 362,E(): 5.4e-17, (56.0% identity in 100 aa overlap); etc. |
Functional category | |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 2708210 | 2708524 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2469c|rplU MMATYAIVKTGGKQYKVAVGDVVKVEKLESEQGEKVSLPVALVVDGATVTTDAKALAKVAVTGEVLGHTKGPKIRIHKFKNKTGYHKRQGHRQQLTVLKVTGIA
Bibliography
No article yet recorded