Gene Mb2477c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | PROBABLE RESUSCITATION-PROMOTING FACTOR RPFE |
| Comments | Mb2477c, rpfE, len: 172 aa. Equivalent to Rv2450c,len: 172 aa, from Mycobacterium tuberculosis strain H37Rv,(99.4% identity in 172 aa overlap). Probable rpfE,resuscitation-promoting factor (see first citation below),similar to O86308|Z96935|MLRPF_1 RPF PROTEIN PRECURSOR from Micrococcus luteus (220 aa), FASTA scores: opt: 291,E(): 3e-7, (48.75% identity in 80 aa overlap). C-terminus is similar to other Mycobacterial rpf proteins e.g. O05594|Rv1009|MTCI237.26|RPFB PROBABLE RESUSCITATION-PROMOTING FACTOR from Mycobacterium tuberculosis (362 aa), FASTA scores: opt: 344, E(): 1.4e-09, (42.85% identity in 147 aa overlap); etc. C-terminal region similar to N-terminal region of Q9F2Q2|SCE41.06c PUTATIVE SECRETED PROTEIN from Streptomyces coelicolor (244 aa), FASTA scores: opt: 355,E(): 3.1e-10, (56.65% identity in 90 aa overlap). Also similar to Q9F2Q1|SCE41.07c PUTATIVE SECRETED PROTEIN from Streptomyces coelicolor (near Q9F2Q2|SCE41.06c) (341 aa) FASTA scores: opt: 317, E(): 2.5e-08, (51.7% identity in 87 aa overlap). With Mycobacterium leprae, high similarity between the two corresponding C-terminal regions of two HYPOTHETICAL PROTEINS, Q9CD53|ML0240 (375 aa), FASTA scores: opt: 339, E(): 2.5e-09, (59.15% identity in 93 aa overlap) and O33049|MLCB57.05c|ML2151 (174 aa), FASTA scores: opt: 329, E(): 4e-09, (58.14% identity in 86 aa overlap). Contains a possible secretory signal sequence in N-terminus. Possible autocrine and/or paracrine bacterial growth factor or cytokine (see citation below). |
| Functional category | |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2719825 | 2720343 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2477c|rpfE
MKNARTTLIAAAIAGTLVTTSPAGIANADDAGLDPNAAAGPDAVGFDPNLPPAPDAAPVDTPPAPEDAGFDPNLPPPLAPDFLSPPAEEAPPVPVAYSVNWDAIAQCESGGNWSINTGNGYYGGLQFTAGTWRANGGSGSAANASREEQIRVAENVLRSQGIRAWPVCGRRG
Bibliography
No article yet recorded
