Gene Mb2495c
in Mycobacterium bovis AF2122/97
General annotation
Type | CDS |
Function | Unknown |
Product | conserved protein |
Comments | Mb2495c, -, len: 167 aa. Equivalent to Rv2468c,len: 167 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 167 aa overlap). Conserved hypothetical protein, highly similar to Mycobacterium leprae HYPOTHETICAL PROTEINS Q9CC58|ML1255 (163 aa), FASTA scores: opt: 859, E(): 1.6e-49, (81.2% identity in 165 aa overlap) and Q9X7B5|MLCB1610.16 (169 aa), FASTA scores: opt: 859, E(): 1.6e-49, (81.2% identity in 165 aa overlap). Also weak similarity with Q9X8D7|SCE39.14c PUTATIVE GNTR-FAMILY REGULATOR from Streptomyces coelicolor (243 aa), FASTA scores: opt: 116, E(): 1.3,(30.1% identity in 156 aa overlap). |
Functional category | Conserved hypotheticals |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 2739807 | 2740310 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2495c|Mb2495c MTHRSSRLEVGPVARGDVATIEHAELPPGWVLTTSGRISGVTEPGELSVHYPFPIADLVALDDALTYSSRACQVRFAIYLGDLGRDTAARAREILGKVPTPDNAVLLAVSPNQCAIEVVYGSQVRGRGAESAAPLGVAAASSAFEQGELVDGLISAIRVLSAGIAPG
Bibliography
No article yet recorded