Gene Mb2502c
in Mycobacterium bovis AF2122/97
General annotation
Type | CDS |
Function | Unknown |
Product | conserved protein |
Comments | Mb2502c, -, len: 138 aa. Equivalent to Rv2475c,len: 138 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 138 aa overlap). Conserved hypothetical protein, showing similarity with Q9L245|SC6D10.19c HYPOTHETICAL 16.2 KDA PROTEIN from Streptomyces coelicolor (136 aa), FASTA scores: opt: 236,E(): 1.9e-09, (34.1% identity in 126 aa overlap). Also some similarity with AAK44393|Z97050|MTCI28_3 CONSERVED HYPOTHETICAL PROTEIN from Mycobacterium tuberculosis cosmid I (151 aa), FASTA scores: opt: 147, E(): 0.00025,(29.2% identity in 120 aa overlap). |
Functional category | Conserved hypotheticals |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 2745138 | 2745554 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2502c|Mb2502c MSVGFVTPVGVRWSDIDMYQHVNHATMVTILEEARVPFLKDAFGADITSTGLLIADVRVTYKGQLRLSDSPLQVTIWTKRLRAVDFTLGYEVRSVNAEPDSRPAVIAESQLAAFHIEEQRLVRLSPHHREYLQRWFRG
Bibliography
No article yet recorded