Gene Mb2522
in Mycobacterium bovis AF2122/97
General annotation
Type | CDS |
Function | Unknown |
Product | possible toxin vapc38. contains pin domain. |
Comments | Mb2522, -, len: 141 aa. Equivalent to Rv2494, len: 141 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 141 aa overlap). Conserved hypothetical protein, similar to other Mycobacterium tuberculosis hypothetical proteins e.g. P95023|EMBL:Z83863|MTCY159.26|Rv2530c (139 aa) FASTA scores: opt: 380 E(): 6.6e-19, (48.0% identity in 125 aa overlap); O53372|Rv3320c|MTV016.20c (142 aa), FASTA scores: opt: 287, E(): 1.3e-12, (41.6% identity in 125 aa overlap); AAK46915|MT2605 (strain CDC1551) (139 aa) FASTA scores: opt: 380, E(): 6.6e-19 (48.0% identity in 125 aa overlap); etc. |
Functional category | Virulence, detoxification, adaptation |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 2775107 | 2775532 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2522|vapc38 MALLDVNALVALAWDSHIHHARIREWFTANATLGWATCPLTEAGFVRVSTNPKVLPSAIGIADARRVLVALRAVGGHRFLADDVSLVDDDVPLIVGYRQVTDAHLLTLARRRGVRLVTFDAGVFTLAQQRPKTPVELLTIL
Bibliography
No article yet recorded