Gene Mb2534
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | PROBABLE TRANSCRIPTIONAL REGULATORY PROTEIN (PROBABLY TETR-FAMILY) |
| Comments | Mb2534, -, len: 215 aa. Equivalent to Rv2506, len: 215 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 215 aa overlap). Probable transcriptional regulator, tetR family, similar to many others e.g. Q9L078|SCC105.06c PUTATIVE TETR-FAMILY REGULATORY PROTEIN from Streptomyces coelicolor (208 aa),FASTA scores: opt: 333, E(): 1.5e-14, (48.75% identity in 197 aa overlap); Q9X7X6|SC6A5.30c PUTATIVE REGULATORY PROTEIN from Streptomyces coelicolor (404 aa), FASTA scores: opt: 267, E(): 4.8e-10, (30.45% identity in 207 aa overlap) (similarity only with C-terminus for this one); Q9FBI8|SCP8.33c PUTATIVE TETR-FAMILY TRANSCRIPTIONAL REGULATOR from Streptomyces coelicolor (213 aa), FASTA scores: opt: 239, E(): 1.8e-08, (29.9% identity in 184 aa overlap); etc. Also similar to transcriptional regulatory proteins from Mycobacterium tuberculosis e.g. O05858|Rv3208|MTCY07D11.18c (228 aa), FASTA scores: opt: 218, E(): 4.4e-07, (30.35% identity in 191 aa overlap); C-terminus of P95251|Rv1963c|MTV051.01c|MTCY09F9.01 (406 aa), FASTA scores: opt: 238, E(): 3.6e-08, (28.25% identity in 177 aa overlap); P96839|Rv3557c|MTCY06G11.04c (200 aa), FASTA scores: opt: 215, E(): 6.2e-07, (38.25% identity in 148 aa overlap); etc. Equivalent to AAK46885 from Mycobacterium tuberculosis strain CDC1551 (231 aa) but shorter 16 aa. Contains probable helix-turn-helix motif at aa 46-67, (Score 1660, +4.84 SD). BELONGS TO THE TETR/ACRR FAMILY OF TRANSCRIPTIONAL REGULATORS. |
| Functional category | Regulatory proteins |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2788509 | 2789156 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2534|Mb2534
MTASAPDGRPGQPEATNRRSQLKSDRRFQLLAAAERLFAERGFLAVRLEDIGAAAGVSGPAIYRHFPNKESLLVELLVGVSARLLAGARDVTTRSANLAAALDGLIEFHLDFALGEADLIRIQDRDLAHLPAVAERQVRKAQRQYVEVWVGVLRELNPGLAEADARLMAHAVFGLLNSTPHSMKAADSKPARTVRARAVLRAMTVAALSAADRCL
Bibliography
No article yet recorded
