Gene Mb2546c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | unknown protein |
| Comments | Mb2546c, -, len: 83 aa. Equivalent to Rv2517c, len: 83 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 83 aa overlap). Hypothetical unknown protein. Equivalent to AAK46899 from Mycobacterium tuberculosis strain CDC1551 (97 aa) but shorter 14 aa. |
| Functional category | Conserved hypotheticals |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2800307 | 2800558 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2546c|Mb2546c
MNSAIIKIAKWAQSQQWTVEDDASGYTRFYNPQGVYIARFPATPSNEYRRMRDLLGALKKAGLTWPPPSKKERRAQHRKEGAQ
Bibliography
No article yet recorded