Gene Mb2556
in Mycobacterium bovis AF2122/97
General annotation
Type | CDS |
Function | Unknown |
Product | possible toxin vapc17 |
Comments | Mb2556, -, len: 133 aa. Equivalent to Rv2527, len: 133 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 133 aa overlap). Hypothetical protein,showing some similarity to hypothetical proteins from Mycobacterium tuberculosis e.g. P95007|MTCY159.10c|Rv2546 (137 aa), FASTA scores: opt: 206, E(): 1.4e-07, (38.0% identity in 100 aa overlap); O33299|MTV002.22c|Rv2757c (138 aa), FASTA scores: opt: 201, E(): 3.1e-07, (35.7% identity in 126 aa overlap); and P96411|MTCY08D5.24c|Rv0229c (226 aa), FASTA scores: opt: 153, E(): 0.0011, (32.8% identity in 128 aa overlap). |
Functional category | Virulence, detoxification, adaptation |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 2818112 | 2818513 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2556|vapc17 MTTWILDKSAHVRLVAGATPPAGIDLTDLAICDIGELEWLYSARSATDYDSQQTSLRAYQILRAPSDIFDRVRHLQRDLAHHRGMWHRTPLPDLFIAETALHHRAGVLHHDRDYKRIAVVRPGFQACELSRGR
Bibliography
No article yet recorded