Gene Mb2563c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | PROBABLE ELONGATION FACTOR P EFP |
| Comments | Mb2563c, efp, len: 187 aa. Equivalent to Rv2534c,len: 187 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 187 aa overlap). Probable efp,elongation factor P, equivalent to Q9CCS0|EFP|ML0522 ELONGATION FACTOR P from Mycobacterium leprae (187 aa),FASTA scores: opt: 1158, E(): 2.1e-67, (94.1% identity in 186 aa overlap). Also highly similar to many e.g. Q45288|EFP_CORGL from Corynebacterium glutamicum (Brevibacterium flavum) (187 aa), FASTA scores: opt: 843,E(): 3.4e-47, (69.5% identity in 187 aa overlap); Q9KXQ9|EFP from Streptomyces coelicolor (188 aa), FASTA scores: opt: 833, E(): 1.5e-46, (67.0% identity in 188 aa overlap); P49778|EFP_BACSU from Bacillus subtilis (185 aa), FASTA scores: opt: 607, E(): 4.6e-32, (47.8% identity in 182 aa overlap); P33398|EFP_ECOLI|B4147 from Escherichia coli strain K12 (187 aa), FASTA scores: opt: 503, E(): 1.8e-27, (42.3% identity in 182 aa overlap); etc. BELONGS TO THE ELONGATION FACTOR P FAMILY. |
| Functional category | |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2825524 | 2826087 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2563c|efp
MATTADFKNGLVLVIDGQLWTITEFQHVKPGKGPAFVRTKLKNVLSGKVVDKTFNAGVKVDTATVDRRDTTYLYRDGSDFVFMDSQDYEQHPLPEALVGDAARFLLEGMPVQVAFHNGVPLYIELPVTVELEVTHTEPGLQGDRSSAGTKPATLQTGAQINVPLFINTGDKLKVDSRDGSYLGRVNA
Bibliography
No article yet recorded