Gene Mb2568c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | shikimate kinase arok (sk) |
| Comments | Mb2568c, aroK, len: 176 aa. Equivalent to Rv2539c,len: 176 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 176 aa overlap). Probable aroK,shikimate kinase (EC 2.7.1.71) (see citation below),equivalent to Q9CCS5|AROK|ML0517 PUTATIVE SHIKIMATE KINASE from Mycobacterium leprae (199 aa), FASTA scores: opt: 852, E(): 1.3e-42, (79.65% identity in 167 aa overlap). Also highly similar to many e.g. Q9X5D1|AROK_CORG from Corynebacterium glutamicum (Brevibacterium flavum) (169 aa), FASTA scores: opt: 478, E(): 5.4e-21, (47.0% identity in 168 aa overlap); Q9KXQ5|AROK from Streptomyces coelicolor (171 aa), FASTA scores: opt: 465, E(): 3.1e-20,(49.1% identity in 167 aa overlap); P24167|AROK_ECOLI from Escherichia coli strain K12 (172 aa), FASTA scores: opt: 316, E(): 1.3e-11, (38.4% identity in 164 aa overlap); etc. Contains PS00017 ATP/GTP-binding site motif A, and PS01128 Shikimate kinase signature. BELONGS TO THE SHIKIMATE KINASE FAMILY. |
| Functional category | |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2829470 | 2830000 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2568c|aroK
MAPKAVLVGLPGSGKSTIGRRLAKALGVGLLDTDVAIEQRTGRSIADIFATDGEQEFRRIEEDVVRAALADHDGVLSLGGGAVTSPGVRAALAGHTVVYLEISAAEGVRRTGGNTVRPLLAGPDRAEKYRALMAKRAPLYRRVATMRVDTNRRNPGAVVRHILSRLQVPSPSEAAT
Bibliography
No article yet recorded
