Gene Mb2577
in Mycobacterium bovis AF2122/97
General annotation
Type | CDS |
Function | Unknown |
Product | possible antitoxin vapb19 |
Comments | Mb2577, -, len: 85 aa. Equivalent to Rv2547, len: 85 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 85 aa overlap). Conserved hypothetical protein. Some similarity to P71666|YD98_MYCTU|Rv1398c|MT1442|MTCY21B4.15c HYPOTHETICAL 9.4 KDA PROTEIN from Mycobacterium tuberculosis (85 aa),FASTA scores: opt: 108, E(): 0.33, (37.1% identity in 62 aa overlap); CAC45864|SMC01933 CONSERVED HYPOTHETICAL PROTEIN from Rhizobium meliloti (Sinorhizobium meliloti) (71 aa), FASTA scores: opt: 105, E(): 0.46, (28.4% identity in 74 aa overlap); Q97W38|SSO10342 HYPOTHETICAL PROTEIN from Sulfolobus solfataricus (58 aa), FASTA scores: opt: 94, E(): 2.3, (46.95% identity in 49 aa overlap). |
Functional category | Virulence, detoxification, adaptation |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 2836059 | 2836316 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2577|vapb19 MRTQVTLGKEELELLDRAAKASGASRSELIRRAIHRAYGTGSKQERLAALDHSRGSWRGRDFTGTEYVDAIRGDLNERLARLGLA
Bibliography
No article yet recorded