Gene Mb2578
in Mycobacterium bovis AF2122/97
General annotation
Type | CDS |
Function | Unknown |
Product | possible toxin vapc19 |
Comments | Mb2578, -, len: 125 aa. Equivalent to Rv2548, len: 125 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 125 aa overlap). Conserved hypothetical protein. Some similarity to various proteins e.g. P71665|Rv1397c|MTCY21B4.14c HYPOTHETICAL 15.0 KDA PROTEIN from Mycobacterium tuberculosis (133 aa), FASTA scores: opt: 265, E(): 7.1e-12, (42.3% identity in 123 aa overlap); Q97WY5|SSO1975 HYPOTHETICAL PROTEIN from Sulfolobus solfataricus (125 aa), FASTA scores: opt: 131,E(): 0.018, (30.0% identity in 110 aa overlap); O52285|YLE HYPOTHETICAL 14.9 KDA PROTEIN from Agrobacterium radiobacter (133 aa), FASTA scores: opt: 128, E(): 0.03,(32.8% identity in 125 aa overlap); etc. |
Functional category | Virulence, detoxification, adaptation |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 2836313 | 2836690 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2578|vapc19 MKLIDTTIAVDHLRGEPAAAVLLAELINNGEEIAASELVRFELLAGVRESELAALEAFFSAVVWTLVTEDIARIGGRLARRYRSSHRGIDDVDYLIAATAIVVDADLLTTNVRHFPMFPDLQPPY
Bibliography
No article yet recorded