Gene Mb2579c
in Mycobacterium bovis AF2122/97
General annotation
Type | CDS |
Function | Unknown |
Product | possible toxin vapc20 |
Comments | Mb2579c, -, len:131 aa. Equivalent to Rv2549c, len: 131 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 131 aa overlap). Conserved hypothetical protein, showing some similarity to P73415|SLL1715 from Synechocystis sp. strain PCC 6803 (157 aa), FASTA scores: opt: 167, E(): 4.2e-05, (29.45% identity in 129 aa overlap); Q9HHY6|VNG6166H from Halobacterium sp. plasmid pNRC200 strain NRC-1 (144 aa),FASTA scores: opt: 133, E(): 0.011, (29.6% identity in 125 aa overlap); and Q9HSU3|VNG0072H from Halobacterium sp. strain NRC-1 (144 aa), FASTA scores: opt: 113, E(): 0.29,(25.75% identity in 136 aa overlap). |
Functional category | Virulence, detoxification, adaptation |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 2837180 | 2837575 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2579c|vapc20 MIFVDTSFWAALGNAGDARHGTAKRLWASKPPVVMTSNHVLGETWTLLNRRCGHRAAVAAAAIRLSTVVRVEHVTADLEEQAWEWLVRHDEREYSFVDATSFAVMRKKGIQNAYAFDGDFSAAGFVEVRPE
Bibliography
No article yet recorded