Gene Mb2584c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | conserved protein |
| Comments | Mb2584c, -, len: 170 aa. Equivalent to Rv2554c,len: 170 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 170 aa overlap). Conserved hypothetical protein, equivalent to Q9CCS9|ML0513 HYPOTHETICAL PROTEIN from Mycobacterium leprae (184 aa),FASTA scores: opt: 701, E(): 2e-34, (72.05% identity in 161 aa overlap). Also highly similar to Q9KXQ0|SC9C5.24c HYPOTHETICAL 17.7 KDA PROTEIN from Streptomyces coelicolor (167 aa), FASTA scores: opt: 461, E(): 2.3e-20, (54.65% identity in 150 aa overlap); and similar to other hypothetical proteins e.g. Q9KDE4 from Bacillus halodurans (140 aa), FASTA scores: opt: 291, E(): 1.9e-10, (38.7% identity in 137 aa overlap); P74662|SLL1547 from Synechocystis sp. strain PCC 6803 (152 aa), FASTA scores: opt: 290, (36.55% identity in 145 aa overlap); Q52673|YQGF_RHOCA from Rhodobacter capsulatus (Rhodopseudomonas capsulata) (159 aa), FASTA scores: opt: 246, E(): 8.4e-08, (34.8% identity in 135 aa overlap); etc. |
| Functional category | Conserved hypotheticals |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2840710 | 2841222 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2584c|Mb2584c
MVPAQHRPPDRPGDPAHDPGRGRRLGIDVGAARIGVACSDPDAILATPVETVRRDRSGKHLRRLAALAAELEAVEVIVGLPRTLADRIGRSAQDAIELAEALARRVSPTPVRLADERLTTVSAQRSLRQAGVRASEQRAVIDQAAAVAILQSWLDERLAAMAGTQEGSDA
Bibliography
No article yet recorded
