Gene Mb2607
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | CONSERVED HYPOTHETICAL PROTEIN [FIRST PART] |
| Comments | Mb2607, -, len: 83 aa. Equivalent to 5' end of Rv2577, len: 529 aa, from Mycobacterium tuberculosis strain H37Rv, (100.0% identity in 83 aa overlap). Conserved hypothetical protein, showing similarity with various proteins from eukaryotes, in particular phosphatases, e.g. Q9SE01|PAP PURPLE ACID PHOSPHATASE PRECURSOR (EC 3.1.3.2) from Glycine max (Soybean) (464 aa), FASTA scores: opt: 190, E(): 0.00026, (27.3% identity in 388 aa overlap); Q9SVP2|F18A5.90|AT4G13700 HYPOTHETICAL 53.4 KDA PROTEIN from Arabidopsis thaliana (Mouse-ear cress) (474 aa), FASTA scores: opt: 280, E(): 6.6e-10,(27.2% identity in 331 aa overlap); Q9FK32 SIMILARITY TO UNKNOWN PROTEIN from Arabidopsis thaliana (Mouse-ear cress) (529 aa), FASTA scores: opt: 249, E(): 6.2e-08,(25.3% identity in 435 aa overlap); Q12546|APHA ACID PHOSPHATASE PRECURSOR from Aspergillus ficuum (614 aa),FASTA scores: opt: 207, E(): 2.9e-05, (22.95% identity in 458 aa overlap); etc. REMARK-M.bovis-M.tuberculosis: In Mycobacterium tuberculosis strain H37Rv, Rv2577 exists as a single gene. In Mycobacterium bovis, a frameshift due to a single base transition (g-a) splits Rv2577 into 2 parts,Mb2607 and Mb2608. |
| Functional category | |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2868366 | 2868617 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2607|Mb2607
MGADLKQPQDADSPPKGVSRRRFLTTGAAAVVGTGVGAGGTALLSSHPRGPAVWYQRGRSGAPPVGGLHLQFGRNASTEMVVS
Bibliography
No article yet recorded