Gene Mb2627
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | possible toxin vapc40. contains pin domain. |
| Comments | Mb2627, -, len: 134 aa. Equivalent to Rv2596, len: 134 aa, from Mycobacterium tuberculosis strain H37Rv,(99.3% identity in 134 aa overlap). Conserved hypothetical protein, only similar to O07780|Rv0598c|MTCY19H5.24 HYPOTHETICAL 14.8 KDA PROTEIN from Mycobacterium tuberculosis (137 aa), FASTA scores: opt: 254, E(): 8.8e-11, (41.55% identity in 130 aa overlap). |
| Functional category | - |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2893191 | 2893595 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2627|vapc40
MIAPDTSVLVAGFATWHEGHEAAVRALNRGVHLIAHAAVETYSVLTRLPPPHRIAPVAVHAYLADITSSNYLALDARSYRGLTDHLAEHDVTGGATYDALVGFTAKAAGAKLLTRDLRAVETYERLRVEVELVT
Bibliography
No article yet recorded