Gene Mb2634
in Mycobacterium bovis AF2122/97
General annotation
Type | CDS |
Function | Unknown |
Product | possible toxin vapc41. contains pin domain. |
Comments | Mb2634, -, len: 146 aa. Equivalent to Rv2602, len: 146 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 146 aa overlap). Conserved hypothetical protein, some weak similarity with proteins from Mycobacterium tuberculosis (strains H37Rv and CDC1551) e.g. O50457|Rv1242|MTV006.14 (143 aa), FASTA scores: opt: 147, E(): 0.0021, (26.25% identity in 141 aa overlap); P95023|Rv2530c|MTCY159.26 (139 aa), FASTA scores: opt: 131, E(): 0.027, (33.35% identity in 135 aa overlap); O53812|Rv0749|MTV041.23 (142 aa), FASTA scores: opt: 125, E(): 0.072, (26.45% identity in 140 aa overlap). |
Functional category | Virulence, detoxification, adaptation |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 2897801 | 2898241 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2634|vapc41 MLLCDTNIWLALALSGHVHHRASRAWLDTINAPGVIHFCRATQQSLLRLLTNRTVLGAYGSPPLTNREAWAAYAAFLDDDRIVLAGAEPDGLEAQWRAFAVRQSPAPKVWMDAYLAAFALTGGFELVTTDTAFTQYGGIELRLLAK
Bibliography
No article yet recorded