Gene Mb2644c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | pi synthase pgsa1 (phosphatidylinositol synthase) (cdp-diacylglycerol--inositol-3-phosphatidyltransferase) |
| Comments | Mb2644c, pgsA1, len: 217 aa. Equivalent to Rv2612c,len: 217 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 217 aa overlap). Probable pgsA1 (previously known as pgsA), PI synthase/CDP-diacylglyceride--inositol phosphatidyltransferase (EC 2.7.8.11), transmembrane protein, equivalent to O07149|MLCL581.16c|PGSA|ML0454 PUTATIVE PHOSPHATIDYLTRANSFERASE from Mycobacterium leprae (239 aa), FASTA scores: opt: 1141, E(): 4.1e-70, (79.35% identity in 213 aa overlap); and Q9F7Y9|PGSA PHOSPHATIDYLINOSITOL SYNTHASE from Mycobacterium smegmatis (222 aa), FASTA scores: opt: 981, E(): 2.7e-59, (67.3% identity in 217 aa overlap) (see citation below). Also similar to other proteins e.g. Q9L282|SCL2.17c PUTATIVE MEMBRANE TRANSFERASE from Streptomyces coelicolor (241 aa), FASTA scores: opt: 564, E(): 4.9e-31, (43.4% identity in 212 aa overlap); Q9UYD0|PGSA-LIKE|PAB1041 CDP-DIACYLGLYCEROL--GLYCEROL-3-PHOSPHATE 3-PHOSPHATIDYLTRANSFERASE from Pyrococcus abyssi (186 aa),FASTA scores: opt: 264, E(): 8.4e-11, (33.15% identity in 190 aa overlap); Q9HQS2|PGSA|VNG1030G CDP-DIACYLGLYCEROL-GLYCEROL-3-PHOSPHATE 3-PHOSPHATIDYLTRANSFERASE from Halobacterium sp. strain NRC-1 (199 aa), FASTA scores: opt: 249, E(): 9.1e-10,(32.1% identity in 193 aa overlap); etc. Contains PS00379 CDP-alcohol phosphatidyltransferases signature. BELONGS TO THE CDP-ALCOHOL PHOSPHATIDYLTRANSFERASE CLASS-I FAMILY. Note that in M. smegmatis, the psgA homolog is essential to the survival of the bacteria and seems cannot be compensated by any other enzyme of M. smegmatis. |
| Functional category | |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2907416 | 2908069 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2644c|pgsA1
MSKLPFLSRAAFARITTPIARGLLRVGLTPDVVTILGTTASVAGALTLFPMGKLFAGACVVWFFVLFDMLDGAMARERGGGTRFGAVLDATCDRISDGAVFCGLLWWIAFHMRDRPLVIATLICLVTSQVISYIKARAEASGLRGDGGFIERPERLIIVLTGAGVSDFPFVPWPPALSVGMWLLAVASVITCVQRLHTVWTSPGAIDRMAIPGKGDR
Bibliography
No article yet recorded
