Gene Mb2649
in Mycobacterium bovis AF2122/97
General annotation
Type | CDS |
Function | Unknown |
Product | conserved protein |
Comments | Mb2649, -, len: 166 aa. Equivalent to Rv2616, len: 166 aa, from Mycobacterium tuberculosis strain H37Rv,(99.4% identity in 166 aa overlap). Conserved hypothetical protein, highly similar to bacterial proteins: Q9L1G0|SC3D11.02c HYPOTHETICAL 20.3 KDA PROTEIN from Streptomyces coelicolor (188 aa), FASTA scores: opt: 407,E(): 2.3e-20, (44.0% identity in 159 aa overlap); Q9X945 A3(2) GLYCOGEN METABOLISM CLUSTER from Streptomyces coelicolor (134 aa), FASTA scores: opt: 330, E(): 2.5e-15,(46.65% identity in 120 aa overlap) (N-terminus shorter); Q9RST8|DR2035 CONSERVED HYPOTHETICAL PROTEIN from Deinococcus radiodurans (198 aa), FASTA scores: opt: 228,E(): 2.4e-08, (35.1% identity in 168 aa overlap). |
Functional category | Conserved hypotheticals |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 2912796 | 2913296 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2649|Mb2649 MDLNALADLPLTYPEVGATATGRLPAGYNHLDVSTQIGTGRQRFEQAADAVMHWGMQRNAGLRVRASSETAIVSAVVLVGIAFLRAPCRVVYVIDEPDVRGFGYGTLPGHPVSGEERFAVRCDPMTSVVFAEVLSFSRPATWASKAAGPLGAVTQRFIAQRYLRAV
Bibliography
No article yet recorded