Gene Mb2659c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | hypoxic response protein 1 hrp1 |
| Comments | Mb2659c, -, len: 143 aa. Equivalent to Rv2626c,len: 143 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 143 aa overlap). Conserved hypothetical protein, similar to CAC49670|SMB21441 PUTATIVE INOSINE-5'-MONOPHOSPHATE DEHYDROGENASE PROTEIN (EC 1.1.1.205) from Rhizobium meliloti (Sinorhizobium meliloti) (120 aa), FASTA scores: opt: 287, E(): 6.6e-12,(43.75% identity in 112 aa overlap) (has its N-terminus shorter 27 aa); AAK78655|CAC0678 CBS DOMAINS from Clostridium acetobutylicum (142 aa), FASTA scores: opt: 276, E(): 3.9e-11, (35.65% identity in 115 aa overlap); Q9K9P0|BH2605 BH2605 PROTEIN from Bacillus halodurans (142 aa), FASTA scores: opt: 276, E(): 3.9e-11, (35.65% identity in 115 aa overlap); etc. Also some similarity to P71737|Rv2406c|MTCY253.14 HYPOTHETICAL 15.1 KDA PROTEIN from Mycobacterium tuberculosis (142 aa), FASTA scores: opt: 145, E(): 0.00012, (22.3% identity in 112 aa overlap). |
| Functional category | Conserved hypotheticals |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2920025 | 2920456 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2659c|hrp1
MTTARDIMNAGVTCVGEHETLTAAAQYMREHDIGALPICGDDDRLHGMLTDRDIVIKGLAAGLDPNTATAGELARDSIYYVDANASIQEMLNVMEEHQVRRVPVISEHRLVGIVTEADIARHLPEHAIVQFVKAICSPMALAS
Bibliography
No article yet recorded
