Gene Mb2665c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | conserved protein |
| Comments | Mb2665c, -, len: 93 aa. Equivalent to Rv2632c, len: 93 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 93 aa overlap). Conserved hypothetical protein, highly similar to conserved hypothetical proteins from Mycobacterium tuberculosis: P71996|YH38_MYCTU|Rv1738|MT1780|MTCY04C12.23 (94 aa),FASTA scores: opt: 319, E(): 4.2e-15, (53.95% identity in 89 aa overlap); and Q9KK61 from Mycobacterium bovis BCG (56 aa), FASTA scores: opt: 178, E(): 9.2e-06, (52.95% identity in 51 aa overlap). |
| Functional category | Conserved hypotheticals |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2926371 | 2926652 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2665c|Mb2665c
MTDSEHVGKTCQIDVLIEEHDERTRAKARLSWAGRQMVGVGLARLDPADEPVAQIGDELAIARALSDLANQLFALTSSDIEASTHQPVTGLHH
Bibliography
No article yet recorded