Gene Mb2693
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | probable peptide methionine sulfoxide reductase msrb (protein-methionine-r-oxide reductase) (peptide met(o) reductase) |
| Comments | Mb2693, -, len: 136 aa. Equivalent to Rv2674, len: 136 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 136 aa overlap). Conserved hypothetical protein, highly similar to various proteins e.g. Q9X828|SC9B1.08 PUTATIVE OXIDOREDUCTASE from Streptomyces coelicolor (135 aa), FASTA scores: opt: 653,E(): 1.8e-37, (71.1% identity in 128 aa overlap); O26807|MTH711 TRANSCRIPTIONAL REGULATOR from Methanothermobacter thermautotrophicus (151 aa), FASTA scores: opt: 533, E(): 2.7e-29, (58.15% identity in 129 aa overlap); Q9C5C8|AT4G21860 HYPOTHETICAL 22.0 KDA PROTEIN from Arabidopsis thaliana (Mouse-ear cress) (202 aa),FASTA scores: opt: 490, E(): 2.8e-26, (54.05% identity in 124 aa overlap); P39903|YEAA_ECOLI|B1778|Z2817|ECS2487 HYPOTHETICAL PROTEIN from Escherichia coli strains K12 and O157:H7 (137 aa), FASTA scores: opt: 426, E(): 4.4e-22,(46.8% identity in 126 aa overlap). |
| Functional category | Intermediary metabolism and respiration |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2947240 | 2947650 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2693|msrb
MTRPKLELSDDEWRQKLTPQEFHVLRRAGTERPFTGEYTDTTTAGIYQCRACGAELFRSTEKFESHCGWPSFFDPKSSDAVTLRPDHSLGMTRTEVLCANCDSHLGHVFAGEGYPTPTDKRYCINSISLRLVPGSV
Bibliography
No article yet recorded
