Gene Mb2702
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | conserved protein |
| Comments | Mb2702, -, len: 165 aa. Equivalent to Rv2683, len: 165 aa, from Mycobacterium tuberculosis strain H37Rv,(99.4% identity in 165 aa overlap). Conserved hypothetical protein, equivalent, but shorter 19 aa, to Q49999|ML1037|U1764Q HYPOTHETICAL PROTEIN from Mycobacterium leprae (184 aa), FASTA scores: opt: 750,E(): 1.2e-41, (73.8% identity in 164 aa overlap). Shows some similarity with other HYPOTHETICAL PROTEINS e.g. Q988S9|MLL6611 from Rhizobium loti (Mesorhizobium loti) (232 aa), FASTA scores: opt: 128, E(): 0.25, (25.5% identity in 149 aa overlap); Q9YFL5|APE0233 from Aeropyrum pernix (340 aa), FASTA scores: opt: 123, E(): 0.73, (29.1% identity in 141 aa overlap); BAB60477|TVG1377730 from Thermoplasma volcanium (174 aa), FASTA scores: opt: 118,E(): 0.86, (28.8% identity in 59 aa overlap); etc. |
| Functional category | Conserved hypotheticals |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2956748 | 2957245 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2702|Mb2702
MKVNIDPTAPTFATYRRDMRAEQMAEDYPVVSIDSDALDAARMLAEHRLPGLLVTAGAGKQYAVLPASQVVRFIVPRYVQDDPSLAGVLNESTADRCAERLSGKKVRDVLPDHLVEVPPANADDTIIEVAAVMARLRSPLLAVVKDGSLLGVVTASRLLAAALKT
Bibliography
No article yet recorded
