Gene Mb2713c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | conserved protein |
| Comments | Mb2713c, -, len: 122 aa. Equivalent to Rv2694c,len: 122 aa, from Mycobacterium tuberculosis strain H37Rv,(99.2% identity in 122 aa overlap). Conserved hypothetical protein, highly similar in part to SC2E9.14 HYPOTHETICAL 16.9 KDA PROTEIN from Streptomyces coelicolor (154 aa),FASTA scores: opt: 299, E(): 1.9e-13, (41.05% identity in 117 aa overlap. Equivalent to AAK47083 from Mycobacterium tuberculosis strain CDC1551 (157 aa) but shorter 35 aa. |
| Functional category | Conserved hypotheticals |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2968035 | 2968403 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2713c|Mb2713c
MGAQGYLRRLTRRLTEDLEQRDVEELSDEVLNAGAQRAIDCQRGQEVTVVGTLRSVETNGKGCSGGVSAELFDGSDTVTLVWLGQRRIPGIDTGRTLRVRGRLGKLENGTKAIYNPHYEIQR
Bibliography
No article yet recorded