Gene Mb2717
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | PROBABLE CONSERVED ALANINE RICH TRANSMEMBRANE PROTEIN |
| Comments | Mb2717, -, len: 161 aa. Equivalent to Rv2698, len: 161 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 161 aa overlap). Probable conserved ala-rich transmembrane protein, equivalent to Q49991|ML1027|U1764I POSSIBLE MEMBRANE PROTEIN from Mycobacterium leprae (157 aa), FASTA scores: opt: 886,E(): 1.1e-49, (78.9% identity in 161 aa overlap). Also similar to O54132|SC2E9.07c HYPOTHETICAL 16.5 KDA PROTEIN from Streptomyces coelicolor (154 aa), FASTA scores: opt: 230, E(): 7.1e-08, (35.7% identity in 154 aa overlap). |
| Functional category | Cell wall and cell processes |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2970809 | 2971294 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2717|Mb2717
MSGTRLAPHSVRYRERLWVPWWWWPLAFALAALIAFEVNLGVAALPDWVPFATLFTVAAGTLLWLGRVEIRVTAGSADGAGVKLWAGPAHLPVAVIARSAEIPATAKSAALGRQLDPAAYVLHRAWVGPMVLVVLDDPNDPTPYWLVSCRHPERVLSALRS
Bibliography
No article yet recorded