Gene Mb2736c
in Mycobacterium bovis AF2122/97
General annotation
Type | CDS |
Function | Unknown |
Product | conserved protein |
Comments | Mb2736c, -, len: 164 aa. Equivalent to Rv2717c,len: 164 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 164 aa overlap). Conserved hypothetical protein, equivalent to Q9CCB8|ML1006 (alias Q49838 but shortened N-terminus) HYPOTHETICAL PROTEIN from Mycobacterium leprae (161 aa), FASTA scores: opt: 797,E(): 2.3e-46, (73.8% identity in 164 aa overlap). Also highly similar to other eukaryotic proteins e.g. O64527|YUP8H12R.14 HYPOTHETICAL PROTEIN from Arabidopsis thaliana (Mouse-ear cress) (166 aa), FASTA scores: opt: 393, E(): 2.3e-19, (42.4% identity in 158 aa overlap); Q9Y325 CGI-36 PROTEIN from Homo sapiens (Human) (165 aa),FASTA scores: opt: 294, E(): 9.5e-13, (33.95% identity in 159 aa overlap); etc. |
Functional category | Conserved hypotheticals |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 2986503 | 2986997 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2736c|Mb2736c MTRDLAPALQALSPLLGSWAGRGAGKYPTIRPFEYLEEVVFAHVGKPFLTYTQQTRAVADGKPLHSETGYLRVCRPGCVELVLAHPSGITEIEVGTYSVTGDVIELELSTRADGSIGLAPTAKEVTALDRSYRIDGDELSYSLQMRAVGQPLQDHLAAVLHRQR
Bibliography
No article yet recorded