Gene Mb2739
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | REPRESSOR LEXA |
| Comments | Mb2739, lexA, len: 217 aa. Equivalent to Rv2720,len: 217 aa, from Mycobacterium tuberculosis strain H37Rv,(99.5% identity in 217 aa overlap). LexA repressor (EC 3.4.21.88) (see citations below), equivalent to Q49848|LEXA_MYCLE|ML1003|B2235_F2_55 LEXA REPRESSOR from Mycobacterium leprae (217 aa), FASTA scores: opt: 1255,E(): 7.1e-70, (89.8% identity in 216 aa overlap). Also highly similar to others e.g. O69979|LEXA_STRCO|SC4H2.24c from Streptomyces coelicolor (234 aa), FASTA scores: opt: 1034, E(): 2.6e-56, (70.5% identity in 217 aa overlap); O86847|LEXA_STRCL from Streptomyces clavuligerus (239 aa),FASTA scores: opt: 1021, E(): 1.6e-55, (69.1% identity in 217 aa overlap); Q9KAD3|LEXA_BACHD from Bacillus halodurans (207 aa), FASTA scores: opt: 645, E(): 1.5e-32,(47.9% identity in 213 aa overlap); etc. BELONGS TO PEPTIDASE FAMILY S24; ALSO KNOWN AS THE UMUD/LEXA FAMILY. |
| Functional category | Regulatory proteins |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2988481 | 2989134 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2739|lexA
MLSADSALTERQRTILDVIRASVTSRGYPPSIREIGDAVGLTSTSSVAHQLRTLERKGYLRRDPNRPRAVNVRGADDAALPPVTEVAGSDALPEPTFAPVLGRIAAGGPILAEEAVEDVFPLPRELVGEGTLFLLKVIGDSMVEAAICDGDWVVVRQQNVADNGDIVAAMIDGEATVKTFKRAGGQVWLMPHNPAFDPIPGNDATVLGKVVTVIRKV
Bibliography
No article yet recorded