Gene Mb2770
in Mycobacterium bovis AF2122/97
General annotation
Type | CDS |
Function | Unknown |
Product | conserved protein |
Comments | Mb2770, -, len: 104 aa. Equivalent to Rv2749, len: 104 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 104 aa overlap). Conserved hypothetical protein, showing some similarity with Q9I1R9|PA2198 HYPOTHETICAL PROTEIN from Pseudomonas aeruginosa (114 aa), FASTA scores: opt: 157, E(): 0.00081,(35.0% identity in 100 aa overlap); and O86332|Rv0793|MTV042.03 HYPOTHETICAL 11.2 KDA PROTEIN from Mycobacterium tuberculosis (101 aa), FASTA scores: opt: 143, E(): 0.0062, (26.9% identity in 93 aa overlap). |
Functional category | Conserved hypotheticals |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 3019079 | 3019393 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2770|Mb2770 MPVVVVATLTAKPESVDTVRDILTRAVDDVHREPGCQLYALHETGETFIFVEQWADAEALKAHSGAPAVATMFTAAGEHLVGAPDIKLLQPVPAGDPSKGQLRR
Bibliography
No article yet recorded