Gene Mb2770 
in Mycobacterium bovis AF2122/97
General annotation
      | Type | CDS | 
| Function | Unknown | 
| Product | conserved protein | 
| Comments | Mb2770, -, len: 104 aa. Equivalent to Rv2749, len: 104 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 104 aa overlap). Conserved hypothetical protein, showing some similarity with Q9I1R9|PA2198 HYPOTHETICAL PROTEIN from Pseudomonas aeruginosa (114 aa), FASTA scores: opt: 157, E(): 0.00081,(35.0% identity in 100 aa overlap); and O86332|Rv0793|MTV042.03 HYPOTHETICAL 11.2 KDA PROTEIN from Mycobacterium tuberculosis (101 aa), FASTA scores: opt: 143, E(): 0.0062, (26.9% identity in 93 aa overlap). | 
| Functional category | Conserved hypotheticals | 
| Mutant | Check for mutants available at TARGET website  | 
Coordinates
    | Type | Start | End | Orientation | 
|---|---|---|---|
| CDS | 3019079 | 3019393 | + | 
       Genomic sequence
    
     
         Feature type 
	 Upstream flanking region (bp) 
	 Downstream flanking region (bp) 
	 
         Update
       
       
       
     Protein sequence
    >Mycobacterium bovis AF2122-97|Mb2770|Mb2770
MPVVVVATLTAKPESVDTVRDILTRAVDDVHREPGCQLYALHETGETFIFVEQWADAEALKAHSGAPAVATMFTAAGEHLVGAPDIKLLQPVPAGDPSKGQLRR
      
    Bibliography
    No article yet recorded