Gene Mb2778c
in Mycobacterium bovis AF2122/97
General annotation
Type | CDS |
Function | Unknown |
Product | possible toxin vapc21 |
Comments | Mb2778c, -, len: 138 aa. Equivalent to Rv2757c,len: 138 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 138 aa overlap). Conserved hypothetical protein, similar to several other M. tuberculosis hypothetical proteins e.g. P96411|Rv0229c| MTCY08D5.24c (226 aa), FASTA scores: opt: 354, E(): 4.6e-18, (45.25% identity in 137 aa overlap) (N-terminus longer 89 aa); P95007|RV2546|MTCY159.10c (137 aa), FASTA scores: opt: 265, E(): 7.5e-12, (38.5% identity in 135 aa overlap); O07228|Rv0301|MTCY63.06 (141 aa), FASTA scores: opt: 259, E(): 2.1e-11, (42.4% identity in 132 aa overlap); etc. |
Functional category | Virulence, detoxification, adaptation |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 3026744 | 3027160 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2778c|vapc21 MTTRYLLDKSAAYRAHLPAVRHRLEPLMERGLLARCGITDLEFGVSARSREDHRTLGTYRRDALEYVNTPDTVWVRAWEIQEALTDKGFHRSVKIPDLIIAAVAEHHGIPVMHYDQDFERIAAITRQPVEWVVAPGTA
Bibliography
No article yet recorded