Gene Mb2800c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | conserved protein |
| Comments | Mb2800c, -, len: 156 aa. Equivalent to Rv2778c,len: 156 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 156 aa overlap). Conserved hypothetical protein, similar to Q9CBF7|ML2031 HYPOTHETICAL PROTEIN from Mycobacterium leprae (151 aa),FASTA scores: opt: 227, E(): 8.5e-09, (35.95% identity in 153 aa overlap). Also similar to AAK46204|MT1931.1 HYPOTHETICAL 17.8 KDA PROTEIN from Mycobacterium tuberculosis strain CDC1551 (158 aa), FASTA scores: opt: 238, E(): 1.5e-09, (35.75% identity in 151 aa overlap); or O07748|Rv1883c|MTCY180.35 HYPOTHETICAL 17.3 KDA PROTEIN from Mycobacterium tuberculosis strain H37Rv (158 aa),FASTA scores: opt: 212, E(): 9.7e-08, (34.45% identity in 151 aa overlap); note that AAK46204|MT1931.1 and O07748|Rv1883c|MTCY180.35 are essentially the same protein except for a small (5 aa) gap. |
| Functional category | Conserved hypotheticals |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3042287 | 3042757 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2800c|Mb2800c
MPDPDGPSVTVTVEIDANPDLVYGLITDLPTLASLAEEVVAMQLRKGDDVRKGAVFVGRNENGGRRWTTTCTVTDADPGRVFAFDVRSGIIPISRWQYGIVATEHGCRVTESTWDRRPSWFRAVARMATGVKDRASVNTEHIRRTLQRLKDRAEAG
Bibliography
No article yet recorded