Gene Mb2811
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | PROBABLE TRANSCRIPTIONAL REPRESSOR SIRR |
| Comments | Mb2811, sirR, len: 228 aa. Equivalent to Rv2788,len: 228 aa, from Mycobacterium tuberculosis strain H37Rv,(99.6% identity in 228 aa overlap). Probable sirR,transcriptional repressor, highly similar to others e.g. Q9RRF3|DR2539 PUTATIVE IRON DEPENDENT REPRESSOR from Deinococcus radiodurans (232 aa), FASTA scores: opt: 518,E(): 4.5e-26, (41.2% identity in 221 aa overlap); Q9HRU8|SIRR|VNG0536G from Halobacterium sp. strain NRC-1 (233 aa), FASTA scores: opt: 516, E(): 6.1e-26, (40.45% identity in 220 aa overlap); Q9KIJ2|SLOR REGULATOR SLOR from Streptococcus mutans (217 aa), FASTA scores: opt: 418, E(): 1.2e-19, (36.15% identity in 213 aa overlap); etc. Also some similarity to Q50495|IDER_MYCTU|MTCY05A6.32|IDER|DTXR|Rv2711|MT2784|MTCY 05A6.32 IRON-DEPENDENT REPRESSOR from Mycobacterium tuberculosis (230 aa), FASTA scores: opt: 266, E(): 7.1e-10, (27.6% identity in 221 aa overlap). Contains helix-turn-helix motif at aa 32-53 (Score 1327, +3.71 SD). COULD BELONG TO THE CRP/FNR FAMILY OF TRANSCRIPTIONAL REGULATORS. |
| Functional category | Regulatory proteins |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3053508 | 3054194 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2811|sirR
MRADEEPGDLSAVAQDYLKVIWTAQEWSQDKVSTKMLAERIGVSASTASESIRKLAEQGLVDHEKYGAVTLTDSGRRAALAMVRRHRLLETFLVNELGYRWDEVHDEAEVLEHAVSDRLMARIDAKLGFPQRDPHGAPIPGADGQVPTPPARQLWACRDGDTGTVARISDADPQMLRYFASIGISLDSRLRVLARREFAGMISVAIDSADGATVDLGSPAAQAIWVVS
Bibliography
No article yet recorded
