Gene Mb2822
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | PROBABLE MEMBRANE PROTEIN |
| Comments | Mb2822, -, len: 210 aa. Equivalent to Rv2799, len: 209 aa, from Mycobacterium tuberculosis strain H37Rv,(99.5% identity in 210 aa overlap). Probable membrane protein. REMARK-M.bovis-M.tuberculosis: In Mycobacterium bovis, a 3 bp insertion (*-ggt) leads to a slightly longer product compared to its homolog in Mycobacterium tuberculosis strain H37Rv (210 aa versus 209 aa). |
| Functional category | Cell wall and cell processes |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3064317 | 3064949 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2822|Mb2822
MYTPGKGPPRAGGVVFTRVRLIGGLGALTAAVVVVVGTVGWQGIPPAPTGGDAVQLRSTAAPMSTTMKSPIVATTDPSPFDPCRDIPFDVIQRLGLAYTPPEAEEGLRCHFDAGNYQMAVEPIIWRTYAQTLPPDAIETTIAGHRAAQYWVRKPTYHNSFWYSSCMVTFKTSYGVIQQSLFYSTVYSEPDVDCPSTNLQRANDLVPYYRF
Bibliography
No article yet recorded