Gene Mb2824A
in Mycobacterium bovis AF2122/97
General annotation
Type | CDS |
Function | Unknown |
Product | Possible antitoxin MazE9 |
Comments | Mb2824A, len: 76 aa. Equivalent to Rv2801A len: 76 aa, from Mycobacterium tuberculosis strain H37Rv, (100.0% identity in 76 aa overlap). Transferred from H37Rv annotation using Rapid Annotation Transfer Tool (Nucleic Acids Res. 2011 May; 39(9): e57). Possible mazE9,antitoxin, part of toxin-antitoxin (TA) operon with Rv2801c (See Pandey and Gerdes, 2005; Zhu et al., 2006). This region is a possible MT-complex-specific genomic island (See Becq et al.,2007). |
Functional category | Virulence, detoxification, adaptation |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 3067059 | 3067289 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2824A|mazE9 MKLSVSLSDDDVAILDAYVKRAGLPSRSAGLQHAIRVLRYPTLEDDYANAWQEWSAAGDTDAWEQTVGDGVGDAPR
Bibliography
No article yet recorded