Gene Mb2837
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | CONSERVED HYPOTHETICAL PROTEIN |
| Comments | Mb2837, -, len: 270 aa. Equivalent to Rv2813, len: 270 aa, from Mycobacterium tuberculosis strain H37Rv,(99.6% identity in 270 aa overlap). Conserved hypothetical protein, similar to various proteins (notably secreted proteins) e.g. Q9ZFL2 HYPOTHETICAL 30.4 KDA PROTEIN from Bacillus stearothermophilus (266 aa), FASTA scores: opt: 518, E(): 1.4e-26, (33.85% identity in 266 aa overlap); P45754|GSPA_AERHY|EXEA GENERAL SECRETION PATHWAY PROTEIN from Aeromonas hydrophila (547 aa), FASTA scores: opt: 386, E(): 1.1e-17, (32.05% identity in 265 aa overlap); Q9KPC7|VC2445 GENERAL SECRETION PATHWAY PROTEIN A from Vibrio cholerae (529 aa), FASTA scores: opt: 366, E(): 2.2e-16, (31.1% identity in 270 aa overlap); Q56674|VC0403 MANNOSE-SENSITIVE HEMAGGLUTININ D from Vibrio cholerae (281 aa), FASTA scores: opt: 317, E(): 2.1e-13, (27.85% identity in 262 aa overlap); etc. Also highly similar to AAK40072 Rv2813-LIKE PROTEIN from Mycobacterium celatum (270 aa), FASTA scores: opt: 1628, E(): 2.8e-99, (90.75% identity in 270 aa overlap). Contains PS00017 ATP/GTP-binding site motif A (P-loop). |
| Functional category | Conserved hypotheticals |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3074774 | 3075586 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2837|Mb2837
MMHKLISYYGFSRMPFGRDLAPGMLHRHSAHNEAVARIGWCIADRRIGVITGEVGAGKTVAVRAALASLDRSRHTVIYLPDPTVGVQGIHHRIVASLGGQPLTHHATLAPQAADALAAEQAERGRTPVVVVEEAHLLGYDQLEALRLLTNHDLDSSSPFACLLIGQPTLRRRMKLGVLAALDQRIGLRYAMPPMTDTNTGSYLRHHLKLAGRDDALFSDDAIGLIHQTSRGYPRAVNNLALQALVAAFAADKAIVDESTTRTAIAEVTAD
Bibliography
No article yet recorded