Gene Mb2852A
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Conserved hypothetical protein |
| Comments | Mb2852A, len: 89 aa. Equivalent to Rv2828A len: 89 aa, from Mycobacterium tuberculosis strain H37Rv, (100.0% identity in 89 aa overlap). Transferred from H37Rv annotation using Rapid Annotation Transfer Tool (Nucleic Acids Res. 2011 May; 39(9): e57). Conserved hypothetical protein,present in many mycobacteria. Equivalent to BCG2848c and Mb2852A (100% identity to both in 89 aa overlap) |
| Functional category | Conserved hypotheticals |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3092901 | 3093170 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2852A|Mb2852A
MCRNITELRGLQPPATPVEIAAAARQYVRKVSGITHPSAATAEAFEAAVAEVTATTTRLLDALPPRRQPPKTVPPLRRPDVAARLAGSR
Bibliography
No article yet recorded