Gene Mb2854c
in Mycobacterium bovis AF2122/97
General annotation
Type | CDS |
Function | Unknown |
Product | possible antitoxin vapb22 |
Comments | Mb2854c, -, len: 71 aa. Equivalent to Rv2830c, len: 71 aa, from Mycobacterium tuberculosis strain H37Rv,(98.6% identity in 71 aa overlap). Hypothetical protein,some similarity to Z97182|MTCY19H5.26|Rv0596c Hypothetical protein from Mycobacterium tuberculosis (85 aa), FASTA scores: opt: 88, E(): 1.3, (41.7% identity in 36 aa overlap); and to PHD_BPP1|Q06253 bacteriophage P1 phd gene (73 aa), FASTA scores: opt: 79, E(): 3.8, (35.9% identity in 39 aa overlap). |
Functional category | Virulence, detoxification, adaptation |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 3093580 | 3093795 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2854c|vapb22 MTATEVKAKILSLLDEVAQGEEIEITKHGRTVARLVAATGPHALKGRFSGVAMAAVDDDELFTTGVSWNVS
Bibliography
No article yet recorded