Gene Mb2865c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | CONSERVED HYPOTHETICAL PROTEIN |
| Comments | Mb2865c, -, len: 99 aa. Equivalent to Rv2840c, len: 99 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 99 aa overlap). Conserved hypothetical protein, equivalent to Q9Z5J0|ML1557|MLCB596.13 HYPOTHETICAL 11.6 KDA PROTEIN from Mycobacterium leprae (106 aa), FASTA scores: opt: 501, E(): 2.3e-29, (501% identity in 96 aa overlap). Also highly similar to other hypothetical proteins e.g. Q9KYR0|SC5H4.29 from Streptomyces coelicolor (101 aa), FASTA scores: opt: 256,E(): 1.4e-11, (50.6% identity in 81 aa overlap); Q9APM9 from Myxococcus xanthus (111 aa), FASTA scores: opt: 174,E(): 1.3e-05, (42.25% identity in 97 aa overlap); and similar to to others e.g. N-terminus of CAC41675|SMC02913 from Rhizobium meliloti (Sinorhizobium meliloti) (230 aa),FASTA scores: opt: 172, E(): 3e-05, (42.4% identity in 66 aa overlap). |
| Functional category | Conserved hypotheticals |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3104529 | 3104828 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2865c|Mb2865c
MRTCVGCRKRGLAVELLRVVAVSTGNGNYAVIVDTATSLPGRGAWLHPLRQCAQQAIRRRAFARALRIAGSPDTSAVVEYLESLGELEPPGNRTGSNRT
Bibliography
No article yet recorded