Gene Mb2890
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | antitoxin relf |
| Comments | Mb2890, -, len: 93 aa. Equivalent to Rv2865, len: 93 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 93 aa overlap). Conserved hypothetical protein, showing weak similarity with P58235|YR54_SYNY3|SSR2754 HYPOTHETICAL 9.7 KDA PROTEIN from Synechocystis sp. strain PCC 6803 (87 aa), FASTA scores: opt: 134, E(): 0.007, (30.65% identity in 75 aa overlap); BAB58570|SAV2408 CONSERVED HYPOTHETICAL PROTEIN from Staphylococcus aureus subsp. aureus Mu50 (83 aa),FASTA scores: opt: 124, E(): 0.037, (27.5% identity in 80 aa overlap). Also similar to Rv1247|MTV006.19c HYPOTHETICAL 9.8 KDA PROTEIN from Mycobacterium tuberculosis (89 aa), FASTA scores: opt: 249, E(): 2.6e-11, (44.2% identity in 86 aa overlap). |
| Functional category | Virulence, detoxification, adaptation |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3134053 | 3134334 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2890|relf
MRILPISTIKGKLNEFVDAVSSTQDQITITKNGAPAAVLVGADEWESLQETLYWLAQPGIRESIAEADADIASGRTYGEDEIRAEFGVPRRPH
Bibliography
No article yet recorded