Gene Mb2891
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | toxin relg |
| Comments | Mb2891, -, len: 87 aa. Equivalent to Rv2866, len: 87 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 87 aa overlap). Conserved hypothetical protein, similar to O50461|Rv1246c|MTV006.18c CONSERVED HYPOTHETICAL PROTEIN from Mycobacterium tuberculosis (97 aa), FASTA scores: opt: 290, E(): 3.6e-16, (54.1% identity in 85 aa overlap). |
| Functional category | Virulence, detoxification, adaptation |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3134338 | 3134601 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2891|relg
MPYTVRFTTTARRDLHKLPPRILAAVVEFAFGDLSREPLRVGKPLRRELAGTFSARRGTYRLLYRIDDEHTTVVILRVDHRADIYRR
Bibliography
No article yet recorded