Gene Mb2896
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | possible antitoxin vapb43 |
| Comments | Mb2896, -, len: 85 aa. Equivalent to Rv2871, len: 85 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 85 aa overlap). Conserved hypothetical protein (see citation below), similar to other CONSERVED HYPOTHETICAL PROTEINS from Mycobacterium tuberculosis strains H37Rv and CDC1551 e.g. O50456|Rv1241|MTV006.13 (86 aa), FASTA scores: opt: 172, E(): 2.9e-05, (37.2% identity in 86 aa overlap); O53811|Rv0748|MTV041.22 (85 aa), FASTA scores: opt: 170, E(): 4e-05, (35.3% identity in 85 aa overlap); etc. |
| Functional category | Virulence, detoxification, adaptation |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3139654 | 3139911 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2896|vapb43
MRTTIRIDDELYREVKAKAARSGRTVAAVLEDAVRRGLNPPKPQAAGRYRVQPSGKGGLRPGVDLSSNAALAEAMNDGVSVDAVR
Bibliography
No article yet recorded