Gene Mb2897
in Mycobacterium bovis AF2122/97
General annotation
Type | CDS |
Function | Unknown |
Product | possible toxin vapc43. contains pin domain. |
Comments | Mb2897, -, len: 147 aa. Equivalent to Rv2872, len: 147 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 147 aa overlap). Conserved hypothetical protein (see citation below), similar to other CONSERVED HYPOTHETICAL PROTEINS from Mycobacterium tuberculosis strains H37Rv and CDC1551 e.g. O53683|Rv0277c|MTV035.05c (142 aa), FASTA scores: opt: 357, E(): 1.4e-17, (41.45% identity in 140 aa overlap); O53812|Rv0749|MTV041.23 (142 aa), FASTA scores: opt: 350,E(): 4.3e-17, (41.55% identity in 142 aa overlap); etc. |
Functional category | Virulence, detoxification, adaptation |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 3139898 | 3140341 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2897|vapc43 MLCVDVNVLVYAHRADLREHADYRGLLERLANDDEPLGLPDSVLAGFIRVVTNRRVFTEPTSPQDAWQAVDALLAAPAAMRLRPGERHWMAFRQLASDVDANGNDIADAHLAAYALENNATWLSADRGFARFRRLRWRHPLDGQTHL
Bibliography
No article yet recorded