Gene Mb2898
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | cell surface lipoprotein mpt83 (lipoprotein p23) |
| Comments | Mb2898, mpb83, len: 220 aa. Equivalent to Rv2873,len: 220 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 220 aa overlap). mpt83 (alternate gene name: mpb83), cell surface lipoprotein (see citations below). Also similar to upstream ORF Q50769|MP70_MYCTU|MPT70|MPB70|Rv2875|MT2943|MTCY274.06 which is also known as MAJOR SECRETED IMMUNOGENIC PROTEIN MPT70 PRECURSOR from Mycobacterium tuberculosis (193 aa),FASTA scores: opt: 806, E(): 2.7e-38, (70.25% identity in 185 aa overlap). BELONGS TO THE MPT70 / MPT83 FAMILY. ATTACHED TO THE MEMBRANE BY A LIPID ANCHOR. |
| Functional category | |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3140421 | 3141083 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2898|mpt83
MINVQAKPAAAASLAAIAIAFLAGCSSTKPVSQDTSPKPATSPAAPVTTAAMADPAADLIGRGCAQYAAQNPTGPGSVAGMAQDPVATAASNNPMLSTLTSALSGKLNPDVNLVDTLNGGEYTVFAPTNAAFDKLPAATIDQLKTDAKLLSSILTYHVIAGQASPSRIDGTHQTLQGADLTVIGARDDLMVNNAGLVCGGVHTANATVYMIDTVLMPPAQ
Bibliography
No article yet recorded