Gene Mb2928c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | 50s ribosomal protein l19 rpls |
| Comments | Mb2928c, rplS, len: 113 aa. Equivalent to Rv2904c,len: 113 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 113 aa overlap). Probable rplS, 50S ribosomal protein L19, equivalent to O33020|RL19_MYCLE 50S RIBOSOMAL PROTEIN L19 from Mycobacterium leprae (113 aa),FASTA scores: opt: 702, E(): 1.4e-45, (93.8% identity in 113 aa overlap). Also highly similar to others e.g. O69883|RL19_STRCO from Streptomyces coelicolor (116 aa),FASTA scores: opt: 571, E(): 9.5e-36, (77.25% identity in 110 aa overlap); O31742|RL19_BACSU from Bacillus subtilis (115 aa), FASTA scores: opt: 523, E(): 3.8e-32, (72.9% identity in 107 aa overlap); RL19_BACST|P30529 from Bacillus stearothermophilus (116 aa), FASTA scores: opt: 518, E(): 9.1e-32, (71.7% identity in 106 aa overlap); etc. BELONGS TO THE L19P FAMILY OF RIBOSOMAL PROTEINS. |
| Functional category | |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3170428 | 3170769 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2928c|rplS
MNRLDFVDKPSLRDDIPAFNPGDTINVHVKVIEGAKERLQVFKGVVIRRQGGGIRETFTVRKESYGVGVERTFPVHSPNIDHIEVVTRGDVRRAKLYYLRELRGKKAKIKEKR
Bibliography
No article yet recorded