Gene Mb2932c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | CONSERVED HYPOTHETICAL PROTEIN |
| Comments | Mb2932c, -, len: 80 aa. Equivalent to Rv2908c, len: 80 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 80 aa overlap). Conserved hypothetical protein, equivalent to O33015|YT08_MYCLE from Mycobacterium leprae (80 aa), FASTA scores: opt: 492, E(): 3.1e-29, (93.75% identity in 80 aa overlap). Also highly similar to others e.g. O69880|YE09_STRCO from Streptomyces coelicolor (79 aa), FASTA scores: opt: 356, E(): 3e-19,(71.6% identity in 74 aa overlap); Q9KA12|BH2482 PROTEIN from Bacillus halodurans (76 aa), FASTA scores: opt: 220,E(): 2.9e-09, (48.6% identity in 72 aa overlap); O31738|YLQC_BACSU HYPOTHETICAL 9.1 KDA PROTEIN from Bacillus subtilis (81 aa), FASTA scores: opt: 172, E(): 1e-05, (39.2% identity in 74 aa overlap); etc. BELONGS TO THE UPF0109 FAMILY. |
| Functional category | Conserved hypotheticals |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3173421 | 3173663 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2932c|Mb2932c
MSAVVVDAVEHLVRGIVDNPDDVRVDLITSRRGRTVEVHVHPDDLGKVIGRGGRTATALRTLVAGIGGRGIRVDVVDTDQ
Bibliography
No article yet recorded