Gene Mb2933c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | 30s ribosomal protein s16 rpsp |
| Comments | Mb2933c, rpsP, len: 162 aa. Equivalent to Rv2909c,len: 162 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 162 aa overlap). Probable rpsP, 30S ribosomal protein S16, equivalent to O33014|RS16_MYCLE 30S RIBOSOMAL PROTEIN S16 from Mycobacterium leprae (160 aa),FASTA scores: opt: 828, E(): 1.6e-39, (82.5% identity in 160 aa overlap). Also highly similar to others e.g. O69879|RS16_STRCO 30S RIBOSOMAL PROTEIN S16 from Streptomyces coelicolor (139 aa), FASTA scores: opt: 486,E(): 1.9e-20, (56.95% identity in 144 aa overlap); P80379|RS16_THETH 30S RIBOSOMAL PROTEIN S16 from Thermus Thermophilus (88 aa), FASTA scores: opt: 280, E(): 4.8e-09, (53.25% identity in 77 aa overlap) (C-terminus shorter); P21474|RS16_BACSU|RPSP 30S RIBOSOMAL PROTEIN S16 (BS17) from Bacillus subtilis (89 aa,), FASTA scores: opt: 258, E(): 8.2e-08, (42.85% identity in 91 aa overlap) (C-terminus shorter); etc. BELONGS TO THE S16P FAMILY OF RIBOSOMAL PROTEINS. |
| Functional category | |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3173671 | 3174159 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2933c|rpsP
MAVKIKLTRLGKIRNPQYRVAVADARTRRDGRAIEVIGRYHPKEEPSLIEINSERAQYWLSVGAQPTEPVLKLLKITGDWQKFKGLPGAQGRLKVAAPKPSKLEVFNAALAAADGGPTTEATKPKKKSPAKKAAKAAEPAPQPEQPDTPALGGEQAELTAES
Bibliography
No article yet recorded