Gene Mb2953
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | PROBABLE THIOESTERASE TESA |
| Comments | Mb2953, tesA, len: 261 aa. Equivalent to Rv2928,len: 261 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 261 aa overlap). Probable tesA,thioesterase (EC 3.1.2.-), equivalent to Q9Z5K4|ML2359|MLCB12.04c PUTATIVE THIOESTERASE from Mycobacterium leprae (261 aa), FASTA scores: opt: 1326,E(): 3.7e-80, (73.2% identity in 261 aa overlap). Also similar to others e.g. Q9ZGI1 THIOESTERASE II PIKAV from Streptomyces venezuelae (281 aa), FASTA scores: opt: 535,E(): 6.6e-28, (38.05% identity in 234 aa overlap); Q9L4W2|NYSE thioesterase involved in synthesis of the polyene antifungal antibiotic nystatin from Streptomyces noursei (see citation below) (251 aa), FASTA scores: opt: 523, E(): 3.8e-27, (34.53% identity in 223 aa overlap); Q54145 THIOESTERASE from Streptomyces fradiae (253 aa),FASTA scores: opt: 495, E(): 2.7e-25, (37.85% identity in 230 aa overlap); etc. |
| Functional category | Lipid metabolism |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3198771 | 3199556 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2953|tesA
MLARHGPRYGGSVNGHSDDSSGDAKQAAPTLYIFPHAGGTAKDYVAFSREFSADVKRIAVQYPGQHDRSGLPPLESIPTLADEIFAMMKPSARIDDPVAFFGHSMGGMLAFEVALRYQSAGHRVLAFFVSACSAPGHIRYKQLQDLSDREMLDLFTRMTGMNPDFFTDDEFFVGALPTLRAVRAIAGYSCPPETKLSCPIYAFIGDKDWIATQDDMDPWRDRTTEEFSIRVFPGDHFYLNDNLPELVSDIEDKTLQWHDRA
Bibliography
No article yet recorded