Gene Mb2954
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | HYPOTHETICAL PROTEIN |
| Comments | Mb2954, -, len: 103 aa. Equivalent to Rv2929, len: 103 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 103 aa overlap). Hypothetical unknown protein; unlikely ORF but some weak similarity to C-terminal half of P18319|UREG_KLEAE urease accessory protein from klebsiella aerogenes (205 aa), FASTA scores: opt: 99, E(): 1.1, (38.6% identity in 57 aa overlap). |
| Functional category | Conserved hypotheticals |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3199543 | 3199854 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2954|Mb2954
MIELSYAPDVAGRRSNWPKGSGVNTWTAIRWTFAEDSPYVGTGLERMASDTHGGGGGRPVTPPPPGMHHLGCSRGVLLISSQRDAGHKTCDPAAGGTLTSVLT
Bibliography
No article yet recorded